TNFRSF9 Blocking Peptide (33R-5482)
A synthetic peptide for use as a blocking control in assays to test for specificity of TNFRSF9 antibody, catalog no. 70R-10166
Overview
Overview
| Synonyms | TNFRSF9 control peptide, TNFRSF9 antibody Blocking Peptide, Anti-TNFRSF9 Blocking Peptide, tumor necrosis factor receptor superfamily, member 9 Blocking Peptide, 4-1BB Blocking Peptide, CD137 Blocking Peptide, CDw137 Blocking Peptide, ILA Blocking Peptide, MGC2172 Blocking Peptide, TNFRSF9, TNFRSF-9, TNFRSF 9, TNFRSF-9 Blocking Peptide, TNFRSF 9 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product