TNFRSF9 Blocking Peptide (33R-5482)

A synthetic peptide for use as a blocking control in assays to test for specificity of TNFRSF9 antibody, catalog no. 70R-10166

Synonyms TNFRSF9 control peptide, TNFRSF9 antibody Blocking Peptide, Anti-TNFRSF9 Blocking Peptide, tumor necrosis factor receptor superfamily, member 9 Blocking Peptide, 4-1BB Blocking Peptide, CD137 Blocking Peptide, CDw137 Blocking Peptide, ILA Blocking Peptide, MGC2172 Blocking Peptide, TNFRSF9, TNFRSF-9, TNFRSF 9, TNFRSF-9 Blocking Peptide, TNFRSF 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors