Protein S Blocking Peptide (33R-5808)

A synthetic peptide for use as a blocking control in assays to test for specificity of PROS1 antibody, catalog no. 70R-6073

Synonyms Protein S control peptide, Protein S antibody Blocking Peptide, Anti-Protein S Blocking Peptide, PROS Blocking Peptide, PS 26 Blocking Peptide, PS21 Blocking Peptide, PS22 Blocking Peptide, PS23 Blocking Peptide, PS24 Blocking Peptide, PS25 Blocking Peptide, PROS1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
Molecular Weight 71 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors