Protein S Blocking Peptide (33R-5808)
A synthetic peptide for use as a blocking control in assays to test for specificity of PROS1 antibody, catalog no. 70R-6073
Overview
Overview
| Synonyms | Protein S control peptide, Protein S antibody Blocking Peptide, Anti-Protein S Blocking Peptide, PROS Blocking Peptide, PS 26 Blocking Peptide, PS21 Blocking Peptide, PS22 Blocking Peptide, PS23 Blocking Peptide, PS24 Blocking Peptide, PS25 Blocking Peptide, PROS1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL |
|---|---|
| Molecular Weight | 71 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PROS1 is an anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product