CD55 Blocking Peptide (33R-7141)
A synthetic peptide for use as a blocking control in assays to test for specificity of CD55 antibody, catalog no. 70R-10001
Overview
Overview
| Synonyms | CD55 control peptide, CD55 antibody Blocking Peptide, Anti-CD55 Blocking Peptide, CD55 molecule, decay accelerating factor for complement, Cromer blood group Blocking Peptide, CR Blocking Peptide, CROM Blocking Peptide, DAF Blocking Peptide, TC Blocking Peptide, CD55, CD-55, CD 55, CD-55 Blocking Peptide, CD 55 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI |
|---|---|
| Molecular Weight | 41 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product