INPP5D Blocking Peptide (33R-7282)

A synthetic peptide for use as a blocking control in assays to test for specificity of INPP5D antibody, catalog no. 70R-10226

Synonyms INPP5D control peptide, INPP5D antibody Blocking Peptide, Anti-INPP5D Blocking Peptide, inositol polyphosphate-5-phosphatase, 145kDa Blocking Peptide, MGC104855 Blocking Peptide, MGC142140 Blocking Peptide, MGC142142 Blocking Peptide, SHIP Blocking Peptide, SHIP1 Blocking Peptide, SIP-145 Blocking Peptide, hp51CN Blocking Peptide, INPP5D, INPPD-5, INPPD 5, INPPD-5 Blocking Peptide, INPPD 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPL
Molecular Weight 131 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. Overall, the protein functions as a negative regulator of myeliod cell proliferation and survival.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors