CYP24A1 Blocking Peptide (33R-7779)

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP24A1 antibody, catalog no. 70R-9998

Synonyms CYP24A1 control peptide, CYP24A1 antibody Blocking Peptide, Anti-CYP24A1 Blocking Peptide, cytochrome P450, family 24, subfamily A, polypeptide 1 Blocking Peptide, CP24 Blocking Peptide, CYP24 Blocking Peptide, MGC126273 Blocking Peptide, MGC126274 Blocking Peptide, P450-CC24 Blocking Peptide, CYP24A1, CYPA1-24, CYPA1 24, CYPA1-24 Blocking Peptide, CYPA1 24 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAE
Molecular Weight 55 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors