CD44 Blocking Peptide (33R-8475)

A synthetic peptide for use as a blocking control in assays to test for specificity of CD44 antibody, catalog no. 70R-10225

Synonyms CD44 control peptide, CD44 antibody Blocking Peptide, Anti-CD44 Blocking Peptide, CD44 molecule, Indian blood group Blocking Peptide, CDW44 Blocking Peptide, CSPG8 Blocking Peptide, ECMR-III Blocking Peptide, HCELL Blocking Peptide, IN Blocking Peptide, LHR Blocking Peptide, MC56 Blocking Peptide, MDU2 Blocking Peptide, MDU3 Blocking Peptide, MGC10468 Blocking Peptide, MIC4 Blocking Peptide, MUTCH-I Blocking Peptide, Pgp1 Blocking Peptide, CD44, CD-44, CD 44, CD-44 Blocking Peptide, CD 44 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQN
Molecular Weight 40 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors