FAM135B Blocking Peptide (33R-9192)

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM135B antibody, catalog no. 70R-3897

Synonyms FAM135B control peptide, FAM135B antibody Blocking Peptide, Anti-FAM135B Blocking Peptide, Family With Sequence Similarity 135 Member B Blocking Peptide, C8ORFK32 Blocking Peptide, MGC126009 Blocking Peptide, MGC126010 Blocking Peptide, MGC33221 Blocking Peptide, FAM135, FAM-135, FAM 135, FAM-135 Blocking Peptide, FAM 135 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
Molecular Weight 156 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors