FAM135B Blocking Peptide (33R-9192)
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM135B antibody, catalog no. 70R-3897
Overview
Overview
| Synonyms | FAM135B control peptide, FAM135B antibody Blocking Peptide, Anti-FAM135B Blocking Peptide, Family With Sequence Similarity 135 Member B Blocking Peptide, C8ORFK32 Blocking Peptide, MGC126009 Blocking Peptide, MGC126010 Blocking Peptide, MGC33221 Blocking Peptide, FAM135, FAM-135, FAM 135, FAM-135 Blocking Peptide, FAM 135 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV |
|---|---|
| Molecular Weight | 156 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of FAM135 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product