CYP51A1 Blocking Peptide (33R-9393)
A synthetic peptide for use as a blocking control in assays to test for specificity of CYP51A1 antibody, catalog no. 70R-10000
Overview
Overview
| Synonyms | CYP51A1 control peptide, CYP51A1 antibody Blocking Peptide, Anti-CYP51A1 Blocking Peptide, cytochrome P450, family 51, subfamily A, polypeptide 1 Blocking Peptide, CP51 Blocking Peptide, CYP51 Blocking Peptide, CYPL1 Blocking Peptide, LDM Blocking Peptide, P450-14DM Blocking Peptide, P450L1 Blocking Peptide, CYP51A1, CYPA1-51, CYPA1 51, CYPA1-51 Blocking Peptide, CYPA1 51 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ |
|---|---|
| Molecular Weight | 57 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein participates in the synthesis of cholesterol by catalyzing the removal of the 14alpha-methyl group from lanosterol. Homologous genes are found in all three eukaryotic phyla, fungi, plants, and animals, suggesting that this is one of the oldest cytochrome P450 genes. Two transcript variants encoding different isoforms have been found for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product