MRO Blocking Peptide (33R-9420)

A synthetic peptide for use as a blocking control in assays to test for specificity of MRO antibody, catalog no. 70R-10118

Synonyms MRO control peptide, MRO antibody Blocking Peptide, Anti-MRO Blocking Peptide, maestro Blocking Peptide, B29 Blocking Peptide, C18orf3 Blocking Peptide, FLJ30140 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF
Molecular Weight 30 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors