MRO Blocking Peptide (33R-9420)
A synthetic peptide for use as a blocking control in assays to test for specificity of MRO antibody, catalog no. 70R-10118
Overview
Overview
| Synonyms | MRO control peptide, MRO antibody Blocking Peptide, Anti-MRO Blocking Peptide, maestro Blocking Peptide, B29 Blocking Peptide, C18orf3 Blocking Peptide, FLJ30140 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF |
|---|---|
| Molecular Weight | 30 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product