IDH1 Blocking Peptide (33R-9808)

A synthetic peptide for use as a blocking control in assays to test for specificity of IDH1 antibody, catalog no. 70R-2495

Synonyms IDH1 control peptide, IDH1 antibody Blocking Peptide, Anti-IDH1 Blocking Peptide, Isocitrate Dehydrogenase 1 Blocking Peptide, Nadp+ Soluble Blocking Peptide, IDH Blocking Peptide, IDP Blocking Peptide, PICD Blocking Peptide, IDH1, IDH-1, IDH 1, IDH-1 Blocking Peptide, IDH 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors