IDH1 Blocking Peptide (33R-9808)
A synthetic peptide for use as a blocking control in assays to test for specificity of IDH1 antibody, catalog no. 70R-2495
Overview
Overview
| Synonyms | IDH1 control peptide, IDH1 antibody Blocking Peptide, Anti-IDH1 Blocking Peptide, Isocitrate Dehydrogenase 1 Blocking Peptide, Nadp+ Soluble Blocking Peptide, IDH Blocking Peptide, IDP Blocking Peptide, PICD Blocking Peptide, IDH1, IDH-1, IDH 1, IDH-1 Blocking Peptide, IDH 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ |
|---|---|
| Molecular Weight | 47 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product