CD63 Blocking Peptide (33R-10413)

A synthetic peptide for use as a blocking control in assays to test for specificity of CD63 antibody, catalog no. 70R-10168

Synonyms CD63 control peptide, CD63 antibody Blocking Peptide, Anti-CD63 Blocking Peptide, CD63 molecule Blocking Peptide, LAMP-3 Blocking Peptide, ME491 Blocking Peptide, MLA1 Blocking Peptide, OMA81H Blocking Peptide, TSPAN30 Blocking Peptide, CD63, CD-63, CD 63, CD-63 Blocking Peptide, CD 63 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRK
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. The use of alternate polyadenylation sites has been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors