CATSPER2 antibody (70R-1500)

Rabbit polyclonal CATSPER2 antibody raised against the C terminal of CATSPER2

Synonyms Polyclonal CATSPER2 antibody, Anti-CATSPER2 antibody, MGC33346 antibody, Cation Channel Sperm Associated 2 antibody
Specificity CATSPER2 antibody was raised against the C terminal of CATSPER2
Cross Reactivity Human,Mouse
Applications WB
Immunogen CATSPER2 antibody was raised using the C terminal of CATSPER2 corresponding to a region with amino acids LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK
Assay Information CATSPER2 Blocking Peptide, catalog no. 33R-5202, is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody


Western Blot analysis using CATSPER2 antibody (70R-1500)

CATSPER2 antibody (70R-1500) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CATSPER2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14; the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CATSPER2 antibody (70R-1500) | CATSPER2 antibody (70R-1500) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors