CBR4 Blocking Peptide (33R-7994)
A synthetic peptide for use as a blocking control in assays to test for specificity of CBR4 antibody, catalog no. 70R-10143
Overview
Overview
| Synonyms | CBR4 control peptide, CBR4 antibody Blocking Peptide, Anti-CBR4 Blocking Peptide, carbonyl reductase 4 Blocking Peptide, FLJ14431 Blocking Peptide, SDR45C1 Blocking Peptide, CBR4, CBR-4, CBR 4, CBR-4 Blocking Peptide, CBR 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH |
|---|---|
| Molecular Weight | 25 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria. The homotetramer may act as NADPH-dependent quinone reductase. It has broad substrate specificity and reduces 9,10-phenanthrenequinone, 1,4-benzoquinone and various other o-quinones and p-quinones (in vitro). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product