CBR4 Blocking Peptide (33R-7994)

A synthetic peptide for use as a blocking control in assays to test for specificity of CBR4 antibody, catalog no. 70R-10143

Synonyms CBR4 control peptide, CBR4 antibody Blocking Peptide, Anti-CBR4 Blocking Peptide, carbonyl reductase 4 Blocking Peptide, FLJ14431 Blocking Peptide, SDR45C1 Blocking Peptide, CBR4, CBR-4, CBR 4, CBR-4 Blocking Peptide, CBR 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKH
Molecular Weight 25 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The heteroteramer with HSD17B8 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria. The homotetramer may act as NADPH-dependent quinone reductase. It has broad substrate specificity and reduces 9,10-phenanthrenequinone, 1,4-benzoquinone and various other o-quinones and p-quinones (in vitro).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors