CC2D1B antibody (70R-1958)

Rabbit polyclonal CC2D1B antibody raised against the C terminal of CC2D1B

Synonyms Polyclonal CC2D1B antibody, Anti-CC2D1B antibody, Coiled-Coil And C2 Domain Containing 1B antibody, CC2D, CCD 2, KIAA1836 antibody, CCD-2, RP11-155O18.2 antibody, CCD 2 antibody, CCD-2 antibody
Specificity CC2D1B antibody was raised against the C terminal of CC2D1B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CC2D1B antibody was raised using the C terminal of CC2D1B corresponding to a region with amino acids IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF
Assay Information CC2D1B Blocking Peptide, catalog no. 33R-4207, is also available for use as a blocking control in assays to test for specificity of this CC2D1B antibody


Western Blot analysis using CC2D1B antibody (70R-1958)

CC2D1B antibody (70R-1958) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CC2D1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CC2D1B belongs to the CC2D1 family. It contains 1 C2 domain. A function of Cc2d1b/Cc2d1a and their Drosophila homologue l(2)gd in D.melanogaster in Notch trafficking have been reported.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CC2D1B antibody (70R-1958) | CC2D1B antibody (70R-1958) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors