CCDC70 antibody (70R-3115)

Rabbit polyclonal CCDC70 antibody raised against the middle region of CCDC70

Synonyms Polyclonal CCDC70 antibody, Anti-CCDC70 antibody, FLJ25853 antibody, Coiled-Coil Domain Containing 70 antibody, CCDC70, CCDC-70 antibody, CCDC 70 antibody, CCDC 70, DKFZP434K1172 antibody, CCDC-70
Specificity CCDC70 antibody was raised against the middle region of CCDC70
Cross Reactivity Human
Applications WB
Immunogen CCDC70 antibody was raised using the middle region of CCDC70 corresponding to a region with amino acids TFRGKIHAFRGQILGFWEEERPFWEEEKTFWKEEKSFWEMEKSFREEEKT
Assay Information CCDC70 Blocking Peptide, catalog no. 33R-9074, is also available for use as a blocking control in assays to test for specificity of this CCDC70 antibody

Images

Western Blot analysis using CCDC70 antibody (70R-3115)

CCDC70 antibody (70R-3115) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC70 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of CCDC70 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC70 antibody (70R-3115) | CCDC70 antibody (70R-3115) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors