CCL16 Blocking Peptide (33R-8609)

A synthetic peptide for use as a blocking control in assays to test for specificity of CCL16 antibody, catalog no. 70R-7847

Synonyms CCL16 control peptide, CCL16 antibody Blocking Peptide, Anti-CCL16 Blocking Peptide, chemokine, C-C motif ligand 16 Blocking Peptide, CKb12 Blocking Peptide, HCC-4 Blocking Peptide, ILINCK Blocking Peptide, LCC-1 Blocking Peptide, LEC Blocking Peptide, LMC Blocking Peptide, MGC117051 Blocking Peptide, Mtn-1 Blocking Peptide, NCC-4 Blocking Peptide, NCC4 Blocking Peptide, SCYA16 Blocking Peptide, SCYL4 Blocking Peptide, CCL16, CCL-16, CCL 16, CCL-16 Blocking Peptide, CCL 16 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL
Molecular Weight 11 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCL16 gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL16 displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors