CCNDBP1 Blocking Peptide (33R-6868)

A synthetic peptide for use as a blocking control in assays to test for specificity of CCNDBP1 antibody, catalog no. 70R-9324

Synonyms CCNDBP1 control peptide, CCNDBP1 antibody Blocking Peptide, Anti-CCNDBP1 Blocking Peptide, cyclin D-type binding-protein 1 Blocking Peptide, DIP1 Blocking Peptide, GCIP Blocking Peptide, CCNDBP1, CCNDBP-1, CCNDBP 1, CCNDBP-1 Blocking Peptide, CCNDBP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQS
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors