CCR2 Blocking Peptide (33R-5054)
A synthetic peptide for use as a blocking control in assays to test for specificity of CKR-2 antibody, catalog no. 70R-5967
Overview
Overview
| Synonyms | CCR2 control peptide, CCR2 antibody Blocking Peptide, Anti-CCR2 Blocking Peptide, Chemokine Blocking Peptide, C-C Motif Receptor 2 Blocking Peptide, CC-CKR-2 Blocking Peptide, CCR2A Blocking Peptide, CCR2B Blocking Peptide, CD192 Blocking Peptide, CKR2 Blocking Peptide, CKR2A Blocking Peptide, CKR2B Blocking Peptide, CMKBR2 Blocking Peptide, MCP-1-R Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL |
|---|---|
| Molecular Weight | 42 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product