CCR2 Blocking Peptide (33R-5054)

A synthetic peptide for use as a blocking control in assays to test for specificity of CKR-2 antibody, catalog no. 70R-5967

Synonyms CCR2 control peptide, CCR2 antibody Blocking Peptide, Anti-CCR2 Blocking Peptide, Chemokine Blocking Peptide, C-C Motif Receptor 2 Blocking Peptide, CC-CKR-2 Blocking Peptide, CCR2A Blocking Peptide, CCR2B Blocking Peptide, CD192 Blocking Peptide, CKR2 Blocking Peptide, CKR2A Blocking Peptide, CKR2B Blocking Peptide, CMKBR2 Blocking Peptide, MCP-1-R Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors