CCT7 Blocking Peptide (33R-7811)

A synthetic peptide for use as a blocking control in assays to test for specificity of CCT7 antibody, catalog no. 70R-5634

Synonyms CCT7 control peptide, CCT7 antibody Blocking Peptide, Anti-CCT7 Blocking Peptide, Chaperonin Containing Tcp1 Subunit 7 Blocking Peptide, Eta Blocking Peptide, CCT-ETA Blocking Peptide, Ccth Blocking Peptide, MGC110985 Blocking Peptide, Nip7-1 Blocking Peptide, TCP-1-eta Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR
Molecular Weight 60 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors