CD244 Blocking Peptide (33R-10327)

A synthetic peptide for use as a blocking control in assays to test for specificity of CD244 antibody, catalog no. 70R-10303

Synonyms CD244 control peptide, CD244 antibody Blocking Peptide, Anti-CD244 Blocking Peptide, CD244 molecule, natural killer cell receptor 2B4 Blocking Peptide, 2B4 Blocking Peptide, NAIL Blocking Peptide, NKR2B4 Blocking Peptide, Nmrk Blocking Peptide, SLAMF4 Blocking Peptide, CD244, CD-244, CD 244, CD-244 Blocking Peptide, CD 244 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues FRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDV
Molecular Weight 40 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors