CD244 Blocking Peptide (33R-10327)
A synthetic peptide for use as a blocking control in assays to test for specificity of CD244 antibody, catalog no. 70R-10303
Overview
Overview
| Synonyms | CD244 control peptide, CD244 antibody Blocking Peptide, Anti-CD244 Blocking Peptide, CD244 molecule, natural killer cell receptor 2B4 Blocking Peptide, 2B4 Blocking Peptide, NAIL Blocking Peptide, NKR2B4 Blocking Peptide, Nmrk Blocking Peptide, SLAMF4 Blocking Peptide, CD244, CD-244, CD 244, CD-244 Blocking Peptide, CD 244 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | FRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDV |
|---|---|
| Molecular Weight | 40 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product