CD3E Blocking Peptide (33R-7793)

A synthetic peptide for use as a blocking control in assays to test for specificity of CD3E antibody, catalog no. 70R-9670

Synonyms CD3E control peptide, CD3E antibody Blocking Peptide, Anti-CD3E Blocking Peptide, CD3e molecule, epsilon, CD3-TCR complex Blocking Peptide, FLJ18683 Blocking Peptide, T3E Blocking Peptide, TCRE Blocking Peptide, CD3E, CD-3E, CD 3E, CD-3E Blocking Peptide, CD 3E Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP
Molecular Weight 23 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors