CD3E Blocking Peptide (33R-7793)
A synthetic peptide for use as a blocking control in assays to test for specificity of CD3E antibody, catalog no. 70R-9670
Overview
Overview
| Synonyms | CD3E control peptide, CD3E antibody Blocking Peptide, Anti-CD3E Blocking Peptide, CD3e molecule, epsilon, CD3-TCR complex Blocking Peptide, FLJ18683 Blocking Peptide, T3E Blocking Peptide, TCRE Blocking Peptide, CD3E, CD-3E, CD 3E, CD-3E Blocking Peptide, CD 3E Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYP |
|---|---|
| Molecular Weight | 23 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product