CD7 Blocking Peptide (33R-8460)
A synthetic peptide for use as a blocking control in assays to test for specificity of CD7 antibody, catalog no. 70R-9675
Overview
Overview
| Synonyms | CD7 control peptide, CD7 antibody Blocking Peptide, Anti-CD7 Blocking Peptide, CD7 molecule Blocking Peptide, GP40 Blocking Peptide, LEU-9 Blocking Peptide, TP41 Blocking Peptide, Tp40 Blocking Peptide, CD7, CD-7, CD 7, CD-7 Blocking Peptide, CD 7 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT |
|---|---|
| Molecular Weight | 23 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product