CD7 Blocking Peptide (33R-8460)

A synthetic peptide for use as a blocking control in assays to test for specificity of CD7 antibody, catalog no. 70R-9675

Synonyms CD7 control peptide, CD7 antibody Blocking Peptide, Anti-CD7 Blocking Peptide, CD7 molecule Blocking Peptide, GP40 Blocking Peptide, LEU-9 Blocking Peptide, TP41 Blocking Peptide, Tp40 Blocking Peptide, CD7, CD-7, CD 7, CD-7 Blocking Peptide, CD 7 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT
Molecular Weight 23 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors