CDC23 antibody (70R-5586)

Rabbit polyclonal CDC23 antibody

Synonyms Polyclonal CDC23 antibody, Anti-CDC23 antibody, CDC23, CDC 23, CDC-23, CDC-23 antibody, APC8 antibody, Cell Division Cycle 23 Homolog antibody, CDC 23 antibody
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPL
Assay Information CDC23 Blocking Peptide, catalog no. 33R-2207, is also available for use as a blocking control in assays to test for specificity of this CDC23 antibody

Images

Western Blot analysis using CDC23 antibody (70R-5586)

CDC23 antibody (70R-5586) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDC23 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDC23 antibody (70R-5586) | CDC23 antibody (70R-5586) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors