CDC25C Blocking Peptide (33R-7615)

A synthetic peptide for use as a blocking control in assays to test for specificity of CDC25C antibody, catalog no. 70R-10478

Synonyms CDC25C control peptide, CDC25C antibody Blocking Peptide, Anti-CDC25C Blocking Peptide, cell division cycle 25 homolog C, S. pombe Blocking Peptide, CDC25 Blocking Peptide, CDC25C, CDC-25C, CDC 25C CDC-25C protein, CDC 25C protein
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors