CDC25C Blocking Peptide (33R-7615)
A synthetic peptide for use as a blocking control in assays to test for specificity of CDC25C antibody, catalog no. 70R-10478
Overview
Overview
| Synonyms | CDC25C control peptide, CDC25C antibody Blocking Peptide, Anti-CDC25C Blocking Peptide, cell division cycle 25 homolog C, S. pombe Blocking Peptide, CDC25 Blocking Peptide, CDC25C, CDC-25C, CDC 25C CDC-25C protein, CDC 25C protein |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALRE |
|---|---|
| Molecular Weight | 45 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CDC25C gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product