CDC27 antibody (70R-4087)

Rabbit polyclonal CDC27 antibody

Synonyms Polyclonal CDC27 antibody, Anti-CDC27 antibody, CDC 27 antibody, D0S1430E antibody, D17S978E antibody, CDC27, CDC-27 antibody, HNUC antibody, CDC27Hs antibody, CDC 27, APC3 antibody, Cell Division Cycle 27 Homolog antibody, CDC-27
Cross Reactivity Human
Applications WB
Immunogen CDC27 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKIST
Assay Information CDC27 Blocking Peptide, catalog no. 33R-4514, is also available for use as a blocking control in assays to test for specificity of this CDC27 antibody

Images

Western Blot analysis using CDC27 antibody (70R-4087)

CDC27 antibody (70R-4087) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDC27 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDC27 antibody (70R-4087) | CDC27 antibody (70R-4087) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors