CDC42EP4 Blocking Peptide (33R-8850)
A synthetic peptide for use as a blocking control in assays to test for specificity of CDC42EP4 antibody, catalog no. 70R-2900
Overview
Overview
| Synonyms | CDC42EP4 control peptide, CDC42EP4 antibody Blocking Peptide, Anti-CDC42EP4 Blocking Peptide, Cdc42 Effector Protein Blocking Peptide, Rho Gtpase Binding 4 Blocking Peptide, BORG4 Blocking Peptide, CEP4 Blocking Peptide, KAIA1777 Blocking Peptide, MGC17125 Blocking Peptide, MGC3740 Blocking Peptide, CDC42, CDC-42, CDC 42, CDC-42 Blocking Peptide, CDC 42 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product