CDC42EP4 Blocking Peptide (33R-8850)

A synthetic peptide for use as a blocking control in assays to test for specificity of CDC42EP4 antibody, catalog no. 70R-2900

Synonyms CDC42EP4 control peptide, CDC42EP4 antibody Blocking Peptide, Anti-CDC42EP4 Blocking Peptide, Cdc42 Effector Protein Blocking Peptide, Rho Gtpase Binding 4 Blocking Peptide, BORG4 Blocking Peptide, CEP4 Blocking Peptide, KAIA1777 Blocking Peptide, MGC17125 Blocking Peptide, MGC3740 Blocking Peptide, CDC42, CDC-42, CDC 42, CDC-42 Blocking Peptide, CDC 42 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors