CDC5L antibody (70R-4924)

Rabbit polyclonal CDC5L antibody

Synonyms Polyclonal CDC5L antibody, Anti-CDC5L antibody, CDC 5, dJ319D22.1 antibody, Cdc5 Cell Division Cycle 5-Like antibody, CEF1 antibody, KIAA0432 antibody, PCDC5RP antibody, CDC-5 antibody, hCDC5 antibody, CDC5, CDC 5 antibody, CDC-5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CDC5L antibody was raised using a synthetic peptide corresponding to a region with amino acids LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE
Assay Information CDC5L Blocking Peptide, catalog no. 33R-5034, is also available for use as a blocking control in assays to test for specificity of this CDC5L antibody

Images

Western Blot analysis using CDC5L antibody (70R-4924)

CDC5L antibody (70R-4924) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDC5L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDC5L shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. CDC5L has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDC5L antibody (70R-4924) | CDC5L antibody (70R-4924) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors