CDCA5 Blocking Peptide (33R-8165)

A synthetic peptide for use as a blocking control in assays to test for specificity of CDCA5 antibody, catalog no. 70R-2882

Synonyms CDCA5 control peptide, CDCA5 antibody Blocking Peptide, Anti-CDCA5 Blocking Peptide, Cell Division Cycle Associated 5 Blocking Peptide, MGC16386 Blocking Peptide, CDCA5, CDCA-5, CDCA 5, CDCA-5 Blocking Peptide, CDCA 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors