CDCA5 Blocking Peptide (33R-8165)
A synthetic peptide for use as a blocking control in assays to test for specificity of CDCA5 antibody, catalog no. 70R-2882
Overview
Overview
| Synonyms | CDCA5 control peptide, CDCA5 antibody Blocking Peptide, Anti-CDCA5 Blocking Peptide, Cell Division Cycle Associated 5 Blocking Peptide, MGC16386 Blocking Peptide, CDCA5, CDCA-5, CDCA 5, CDCA-5 Blocking Peptide, CDCA 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product