CDH22 antibody (70R-1834)

Rabbit polyclonal CDH22 antibody raised against the N terminal of CDH22

Synonyms Polyclonal CDH22 antibody, Anti-CDH22 antibody, Cadherin-Like 22 antibody, MGC39564 antibody, dJ998H6.1 antibody, C20orf25 antibody
Specificity CDH22 antibody was raised against the N terminal of CDH22
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CDH22 antibody was raised using the N terminal of CDH22 corresponding to a region with amino acids LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD
Assay Information CDH22 Blocking Peptide, catalog no. 33R-5040, is also available for use as a blocking control in assays to test for specificity of this CDH22 antibody


Western Blot analysis using CDH22 antibody (70R-1834)

CDH22 antibody (70R-1834) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CDH22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDH22 is a member of the cadherin superfamily. CDH22 is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CDH22 antibody (70R-1834) | CDH22 antibody (70R-1834) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors