CDK2 Blocking Peptide (33R-9666)
A synthetic peptide for use as a blocking control in assays to test for specificity of CDK2 antibody, catalog no. 20R-1285
Overview
Overview
| Synonyms | CDK2 control peptide, CDK2 antibody Blocking Peptide, Anti-CDK2 Blocking Peptide, CDK2, CDK-2, CDK 2, CDK-2 Blocking Peptide, CDK 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE |
|---|---|
| Molecular Weight | 34 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Phospho-cdk2 (Thr160) probably involved in the control of the cell cycle. It interacts with cyclins A, D, or E. Activity of cdk2 is maximal during S phase and G2. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product