CDK2 Blocking Peptide (33R-9666)

A synthetic peptide for use as a blocking control in assays to test for specificity of CDK2 antibody, catalog no. 20R-1285

Synonyms CDK2 control peptide, CDK2 antibody Blocking Peptide, Anti-CDK2 Blocking Peptide, CDK2, CDK-2, CDK 2, CDK-2 Blocking Peptide, CDK 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPE
Molecular Weight 34 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phospho-cdk2 (Thr160) probably involved in the control of the cell cycle. It interacts with cyclins A, D, or E. Activity of cdk2 is maximal during S phase and G2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors