CDK4 Blocking Peptide (33R-7335)
A synthetic peptide for use as a blocking control in assays to test for specificity of CDK4 antibody, catalog no. 20R-1280
Overview
Overview
| Synonyms | CDK4 control peptide, CDK4 antibody Blocking Peptide, Anti-CDK4 Blocking Peptide, cyclin-dependent kinase 4 Blocking Peptide, CDK4, CDK-4, CDK 4, CDK-4 Blocking Peptide, CDK 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
|---|---|
| Molecular Weight | 34 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Cdk4 is probably involved in the control of the cell cycle. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product