CDK9 Blocking Peptide (33R-7070)
A synthetic peptide for use as a blocking control in assays to test for specificity of CDK9 antibody, catalog no. 20R-1293
Overview
Overview
| Synonyms | CDK9 control peptide, CDK9 antibody Blocking Peptide, Anti-CDK9 Blocking Peptide, cyclin-dependent kinase 9, CDC2-related kinase Blocking Peptide, RP11-228B15.5 Blocking Peptide, C-2k Blocking Peptide, CDC2L4 Blocking Peptide, PITALRE Blocking Peptide, TAK Blocking Peptide, CDK9, CDK-9, CDK 9, CDK-9 Blocking Peptide, CDK 9 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP |
|---|---|
| Molecular Weight | 43 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CDK9 is the member of the cyclin-dependent kinase pair (CDK9/cyclin-T) complex, also called positive transcription elongation factor b (P-TEFb), which facilitates the transition from abortive to production elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAP II), SUPT5H and RDBP. The CDK9/cyclin-K complex has also a kinase activity toward CTD of RNAP II and can substitute for P-TEFb in vitro. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product