CDK9 Blocking Peptide (33R-7070)

A synthetic peptide for use as a blocking control in assays to test for specificity of CDK9 antibody, catalog no. 20R-1293

Synonyms CDK9 control peptide, CDK9 antibody Blocking Peptide, Anti-CDK9 Blocking Peptide, cyclin-dependent kinase 9, CDC2-related kinase Blocking Peptide, RP11-228B15.5 Blocking Peptide, C-2k Blocking Peptide, CDC2L4 Blocking Peptide, PITALRE Blocking Peptide, TAK Blocking Peptide, CDK9, CDK-9, CDK 9, CDK-9 Blocking Peptide, CDK 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDK9 is the member of the cyclin-dependent kinase pair (CDK9/cyclin-T) complex, also called positive transcription elongation factor b (P-TEFb), which facilitates the transition from abortive to production elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAP II), SUPT5H and RDBP. The CDK9/cyclin-K complex has also a kinase activity toward CTD of RNAP II and can substitute for P-TEFb in vitro.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors