CEP55 antibody (70R-2148)

Rabbit polyclonal CEP55 antibody raised against the N terminal of CEP55

Synonyms Polyclonal CEP55 antibody, Anti-CEP55 antibody, C10orf3 antibody, Centrosomal Protein 55Kda antibody, FLJ10540 antibody, URCC6 antibody
Specificity CEP55 antibody was raised against the N terminal of CEP55
Cross Reactivity Human
Applications WB
Immunogen CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
Assay Information CEP55 Blocking Peptide, catalog no. 33R-6509, is also available for use as a blocking control in assays to test for specificity of this CEP55 antibody


Western Blot analysis using CEP55 antibody (70R-2148)

CEP55 antibody (70R-2148) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CEP55 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CEP55 antibody (70R-2148) | CEP55 antibody (70R-2148) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors