CHCHD4 antibody (70R-2526)

Rabbit polyclonal CHCHD4 antibody raised against the N terminal of CHCHD4

Synonyms Polyclonal CHCHD4 antibody, Anti-CHCHD4 antibody, FLJ31709 antibody, Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 4 antibody, MIA40 antibody
Specificity CHCHD4 antibody was raised against the N terminal of CHCHD4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHCHD4 antibody was raised using the N terminal of CHCHD4 corresponding to a region with amino acids MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNIN
Assay Information CHCHD4 Blocking Peptide, catalog no. 33R-6527, is also available for use as a blocking control in assays to test for specificity of this CHCHD4 antibody


Western Blot analysis using CHCHD4 antibody (70R-2526)

CHCHD4 antibody (70R-2526) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHCHD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CHCHD4 antibody (70R-2526) | CHCHD4 antibody (70R-2526) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors