CHMP4B Blocking Peptide (33R-8000)

A synthetic peptide for use as a blocking control in assays to test for specificity of CHMP4B antibody, catalog no. 70R-4493

Synonyms CHMP4B control peptide, CHMP4B antibody Blocking Peptide, Anti-CHMP4B Blocking Peptide, Chromatin Modifying Protein 4B Blocking Peptide, C20orf178 Blocking Peptide, CHMP4A Blocking Peptide, CTPP3 Blocking Peptide, SNF7 Blocking Peptide, SNF7-2 Blocking Peptide, Shax1 Blocking Peptide, dJ553F4.4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
Molecular Weight 25 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors