CHN2 Blocking Peptide (33R-6714)

A synthetic peptide for use as a blocking control in assays to test for specificity of CHN2 antibody, catalog no. 70R-3064

Synonyms CHN2 control peptide, CHN2 antibody Blocking Peptide, Anti-CHN2 Blocking Peptide, Chimerin Blocking Peptide, Chimaerin 2 Blocking Peptide, ARHGAP3 Blocking Peptide, BCH Blocking Peptide, MGC138360 Blocking Peptide, RHOGAP3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHN2 is a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. CHN2 plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors