CHN2 Blocking Peptide (33R-6714)
A synthetic peptide for use as a blocking control in assays to test for specificity of CHN2 antibody, catalog no. 70R-3064
Overview
Overview
| Synonyms | CHN2 control peptide, CHN2 antibody Blocking Peptide, Anti-CHN2 Blocking Peptide, Chimerin Blocking Peptide, Chimaerin 2 Blocking Peptide, ARHGAP3 Blocking Peptide, BCH Blocking Peptide, MGC138360 Blocking Peptide, RHOGAP3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CHN2 is a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. CHN2 plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product