CHRFAM7A antibody (70R-5198)

Rabbit polyclonal CHRFAM7A antibody raised against the middle region of CHRFAM7A

Synonyms Polyclonal CHRFAM7A antibody, Anti-CHRFAM7A antibody, CHRNA7-DR1 antibody, MGC120482 antibody, Chrna7 antibody, D-10 antibody, Cholinergic Receptor Nicotinic Alpha 7 And Fam7A antibody, CHRNA7 antibody, MGC120483 antibody
Specificity CHRFAM7A antibody was raised against the middle region of CHRFAM7A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CHRFAM7A antibody was raised using the middle region of CHRFAM7A corresponding to a region with amino acids QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM
Assay Information CHRFAM7A Blocking Peptide, catalog no. 33R-7718, is also available for use as a blocking control in assays to test for specificity of this CHRFAM7A antibody

Images

Western Blot analysis using CHRFAM7A antibody (70R-5198)

CHRFAM7A antibody (70R-5198) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHRFAM7A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7 is located on chromosome 15 in a region associated with several neuropsychiatric disorders. CHRFAM7A is is a hybrid between CHRNA7 and FAM7A. The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7, which is located on chromosome 15 in a region associated with several neuropsychiatric disorders, is partially duplicated and forms a hybrid with a novel gene from the family with sequence similarity 7 (FAM7A).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CHRFAM7A antibody (70R-5198) | CHRFAM7A antibody (70R-5198) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors