CHRNB2 antibody (70R-1527)

Rabbit polyclonal CHRNB2 antibody

Synonyms Polyclonal CHRNB2 antibody, Anti-CHRNB2 antibody, Cholinergic Receptor Nicotinic Beta 2 antibody
Cross Reactivity Human
Applications WB
Immunogen CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI
Assay Information CHRNB2 Blocking Peptide, catalog no. 33R-4429, is also available for use as a blocking control in assays to test for specificity of this CHRNB2 antibody

Western Blot analysis using CHRNB2 antibody (70R-1527)

CHRNB2 antibody (70R-1527) used at 5 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CHRNB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using CHRNB2 antibody (70R-1527) | CHRNB2 antibody (70R-1527) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors