Chst2 Blocking Peptide (33R-9537)
A synthetic peptide for use as a blocking control in assays to test for specificity of Chst2 antibody, catalog no. 70R-8651
Overview
Overview
| Synonyms | Chst2 control peptide, Chst2 antibody Blocking Peptide, Anti-Chst2 Blocking Peptide, carbohydrate sulfotransferase 2 Blocking Peptide, AI428561 Blocking Peptide, AW121776 Blocking Peptide, C130041E03Rik Blocking Peptide, Chts2 Blocking Peptide, GST-2 Blocking Peptide, GlcNAc6ST Blocking Peptide, Gn6st Blocking Peptide, Chst2, Chst-2, Chst 2, Chst-2 Blocking Peptide, Chst 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV |
|---|---|
| Molecular Weight | 58 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Chst2 catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within keratan-like structures on N-linked glycans and within mucin-associated glycans that can ultimately serve as L-selectin ligands. L-selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product