Chst2 Blocking Peptide (33R-9537)

A synthetic peptide for use as a blocking control in assays to test for specificity of Chst2 antibody, catalog no. 70R-8651

Synonyms Chst2 control peptide, Chst2 antibody Blocking Peptide, Anti-Chst2 Blocking Peptide, carbohydrate sulfotransferase 2 Blocking Peptide, AI428561 Blocking Peptide, AW121776 Blocking Peptide, C130041E03Rik Blocking Peptide, Chts2 Blocking Peptide, GST-2 Blocking Peptide, GlcNAc6ST Blocking Peptide, Gn6st Blocking Peptide, Chst2, Chst-2, Chst 2, Chst-2 Blocking Peptide, Chst 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV
Molecular Weight 58 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chst2 catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within keratan-like structures on N-linked glycans and within mucin-associated glycans that can ultimately serve as L-selectin ligands. L-selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors