CHTF18 Blocking Peptide (33R-8631)

A synthetic peptide for use as a blocking control in assays to test for specificity of CHTF18 antibody, catalog no. 70R-3759

Synonyms CHTF18 control peptide, CHTF18 antibody Blocking Peptide, Anti-CHTF18 Blocking Peptide, Ctf18 Chromosome Transmission Fidelity Factor 18 Homolog Blocking Peptide, C16orf41 Blocking Peptide, C321D2.2 Blocking Peptide, C321D2.3 Blocking Peptide, C321D2.4 Blocking Peptide, CHL12 Blocking Peptide, Ctf18 Blocking Peptide, RUVBL Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT
Molecular Weight 107 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CHTF18, CHTF8, and DCC1 are components of an alternative replication factor C (RFC) complex that loads PCNA onto DNA during S phase of the cell cycle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors