CHTF18 Blocking Peptide (33R-8631)
A synthetic peptide for use as a blocking control in assays to test for specificity of CHTF18 antibody, catalog no. 70R-3759
Overview
Overview
| Synonyms | CHTF18 control peptide, CHTF18 antibody Blocking Peptide, Anti-CHTF18 Blocking Peptide, Ctf18 Chromosome Transmission Fidelity Factor 18 Homolog Blocking Peptide, C16orf41 Blocking Peptide, C321D2.2 Blocking Peptide, C321D2.3 Blocking Peptide, C321D2.4 Blocking Peptide, CHL12 Blocking Peptide, Ctf18 Blocking Peptide, RUVBL Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT |
|---|---|
| Molecular Weight | 107 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CHTF18, CHTF8, and DCC1 are components of an alternative replication factor C (RFC) complex that loads PCNA onto DNA during S phase of the cell cycle. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product