Chymotrypsinogen B1 Blocking Peptide (33R-9835)
A synthetic peptide for use as a blocking control in assays to test for specificity of CTRB1 antibody, catalog no. 70R-7495
Overview
Overview
| Synonyms | Chymotrypsinogen B1 control peptide, Chymotrypsinogen B1 antibody Blocking Peptide, Anti-Chymotrypsinogen B1 Blocking Peptide, CTRB Blocking Peptide, FLJ42412 Blocking Peptide, MGC88037 Blocking Peptide, CTRB1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product