Chymotrypsinogen B1 Blocking Peptide (33R-9835)

A synthetic peptide for use as a blocking control in assays to test for specificity of CTRB1 antibody, catalog no. 70R-7495

Synonyms Chymotrypsinogen B1 control peptide, Chymotrypsinogen B1 antibody Blocking Peptide, Anti-Chymotrypsinogen B1 Blocking Peptide, CTRB Blocking Peptide, FLJ42412 Blocking Peptide, MGC88037 Blocking Peptide, CTRB1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors