CIB3 antibody (70R-3124)

Rabbit polyclonal CIB3 antibody raised against the N terminal of CIB3

Synonyms Polyclonal CIB3 antibody, Anti-CIB3 antibody, MGC142151 antibody, CIB-3, CIB 3, CIB3, CIB-3 antibody, Calcium And Integrin Binding Family Member 3 antibody, MGC96922 antibody, CIB 3 antibody, KIP3 antibody, MGC138405 antibody
Specificity CIB3 antibody was raised against the N terminal of CIB3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CIB3 antibody was raised using the N terminal of CIB3 corresponding to a region with amino acids QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG
Assay Information CIB3 Blocking Peptide, catalog no. 33R-7504, is also available for use as a blocking control in assays to test for specificity of this CIB3 antibody


Western Blot analysis using CIB3 antibody (70R-3124)

CIB3 antibody (70R-3124) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CIB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of CIB3 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CIB3 antibody (70R-3124) | CIB3 antibody (70R-3124) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors