CK2 alpha 1 antibody (70R-2696)

Rabbit polyclonal CK2 alpha 1 antibody raised against the middle region of CSNK2A1

Synonyms Polyclonal CK2 alpha 1 antibody, Anti-CK2 alpha 1 antibody, CK-2, Casein Kinase 2 Alpha 1 Polypeptide antibody, CK-2 antibody, CK1G3 antibody, CK 2 antibody, CSNK2A1 antibody, CKII alpha antibody, CK2A1 antibody, CK 2, CK2, CKII antibody
Specificity CK2 alpha 1 antibody was raised against the middle region of CSNK2A1
Cross Reactivity Human,Mouse,Rat,C.elegans,Drosophila
Applications WB
Immunogen CK2 alpha 1 antibody was raised using the middle region of CSNK2A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP
Assay Information CK2 alpha 1 Blocking Peptide, catalog no. 33R-4966, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha 1 antibody


Western Blot analysis using CK2 alpha 1 antibody (70R-2696)

CK2 alpha 1 antibody (70R-2696) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CSNK2A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. CSNK2A1 represents the alpha subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CK2 alpha 1 antibody (70R-2696) | CK2 alpha 1 antibody (70R-2696) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors