CKAP2 Blocking Peptide (33R-10332)

A synthetic peptide for use as a blocking control in assays to test for specificity of CKAP2 antibody, catalog no. 70R-10393

Synonyms CKAP2 control peptide, CKAP2 antibody Blocking Peptide, Anti-CKAP2 Blocking Peptide, cytoskeleton associated protein 2 Blocking Peptide, DKFZp686L1238 Blocking Peptide, FLJ10749 Blocking Peptide, LB1 Blocking Peptide, TMAP Blocking Peptide, se20-10 Blocking Peptide, CKAP2, CKAP-2, CKAP 2, CKAP-2 Blocking Peptide, CKAP 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQ
Molecular Weight 77 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CKAP2 is a cytoskeleton-associated protein involved in mitotic progression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors