CKMM Blocking Peptide (33R-3630)
A synthetic peptide for use as a blocking control in assays to test for specificity of CKM antibody, catalog no. 70R-1985
Overview
Overview
| Synonyms | CKMM control peptide, CKMM antibody Blocking Peptide, Anti-CKMM Blocking Peptide, Creatine Kinase Muscle Blocking Peptide, M-CK Blocking Peptide, CK MM Blocking Peptide, Creatine Kinase MM Isoenzyme Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI |
|---|---|
| Molecular Weight | 43 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product