CKMM Blocking Peptide (33R-3630)

A synthetic peptide for use as a blocking control in assays to test for specificity of CKM antibody, catalog no. 70R-1985

Synonyms CKMM control peptide, CKMM antibody Blocking Peptide, Anti-CKMM Blocking Peptide, Creatine Kinase Muscle Blocking Peptide, M-CK Blocking Peptide, CK MM Blocking Peptide, Creatine Kinase MM Isoenzyme Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors