CKMT2 antibody (70R-2315)

Rabbit polyclonal CKMT2 antibody

Synonyms Polyclonal CKMT2 antibody, Anti-CKMT2 antibody, SMTCK antibody, Creatine Kinase Mitochondrial 2 antibody
Cross Reactivity Human
Applications WB
Immunogen CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
Assay Information CKMT2 Blocking Peptide, catalog no. 33R-4160, is also available for use as a blocking control in assays to test for specificity of this CKMT2 antibody


Western Blot analysis using CKMT2 antibody (70R-2315)

CKMT2 antibody (70R-2315) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CKMT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CKMT2 antibody (70R-2315) | CKMT2 antibody (70R-2315) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors