CKMT2 Blocking Peptide (33R-3621)
A synthetic peptide for use as a blocking control in assays to test for specificity of CKMT2 antibody, catalog no. 70R-1093
Overview
Overview
| Synonyms | CKMT2 control peptide, CKMT2 antibody Blocking Peptide, Anti-CKMT2 Blocking Peptide, Creatine Kinase Mitochondrial 2 Blocking Peptide, SMTCK Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product