CLCNKB antibody (70R-5147)

Rabbit polyclonal CLCNKB antibody raised against the C terminal of CLCNKB

Synonyms Polyclonal CLCNKB antibody, Anti-CLCNKB antibody, Chloride Channel Kb antibody
Specificity CLCNKB antibody was raised against the C terminal of CLCNKB
Cross Reactivity Human
Applications WB
Immunogen CLCNKB antibody was raised using the C terminal of CLCNKB corresponding to a region with amino acids ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSW
Assay Information CLCNKB Blocking Peptide, catalog no. 33R-4035, is also available for use as a blocking control in assays to test for specificity of this CLCNKB antibody

Images

Western Blot analysis using CLCNKB antibody (70R-5147)

CLCNKB antibody (70R-5147) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLCNKB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CLCNKB antibody (70R-5147) | CLCNKB antibody (70R-5147) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors