CLECL1 antibody (70R-2614)

Rabbit polyclonal CLECL1 antibody raised against the N terminal of CLECL1

Synonyms Polyclonal CLECL1 antibody, Anti-CLECL1 antibody, DCAL1 antibody, C-Type Lectin-Like 1 antibody
Specificity CLECL1 antibody was raised against the N terminal of CLECL1
Cross Reactivity Human
Applications WB
Immunogen CLECL1 antibody was raised using the N terminal of CLECL1 corresponding to a region with amino acids MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIY
Assay Information CLECL1 Blocking Peptide, catalog no. 33R-6608, is also available for use as a blocking control in assays to test for specificity of this CLECL1 antibody


Western Blot analysis using CLECL1 antibody (70R-2614)

CLECL1 antibody (70R-2614) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLECL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DCAL1 is a type II transmembrane, C-type lectin-like protein expressed on dendritic cells (DCs) and B cells. It interacts with subsets of T cells as a costimulatory molecule that enhances interleukin-4 production.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CLECL1 antibody (70R-2614) | CLECL1 antibody (70R-2614) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors