CLIC1 antibody (70R-5044)

Rabbit polyclonal CLIC1 antibody raised against the C terminal of CLIC1

Synonyms Polyclonal CLIC1 antibody, Anti-CLIC1 antibody, CLIC 1 antibody, CLIC-1 antibody, Chloride Intracellular Channel 1 antibody, CLIC-1, CLIC1, CLIC 1
Specificity CLIC1 antibody was raised against the C terminal of CLIC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Images

Western Blot analysis using CLIC1 antibody (70R-5044)

CLIC1 antibody (70R-5044) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLIC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 (CLIon Channel1) is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CLIC1 antibody (70R-5044) | CLIC1 antibody (70R-5044) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors